Distro — Free Sales Engagement Platform
Sequences, cloud call center, shared inbox, form tracking and more — on a single platform. Double your sales team's output with fewer tools.
Create a sequence — it's free
Sri Kanayakaparameswariseedsandgeneralstores
sri kanayakaparameswariseedsandgeneralstores is a farming company based out of nandyala,kurnool - ongole main rd, giddalur, andhra pradesh, india.
Frequently asked questions about Sri Kanayakaparameswariseedsandgeneralstores
Let us help answer the most common questions you might have.
Where is Sri Kanayakaparameswariseedsandgeneralstores located?
Sri Kanayakaparameswariseedsandgeneralstores' headquarters is located at Giddalūr, Andhra Pradesh, India
What industry does Sri Kanayakaparameswariseedsandgeneralstores belong to?
Sri Kanayakaparameswariseedsandgeneralstores is in the industry of: Farming
What are Sri Kanayakaparameswariseedsandgeneralstores' social media links?
Sri Kanayakaparameswariseedsandgeneralstores Linkedin page
Distro — Free Sales Engagement Platform
Sequences, cloud call center, shared inbox, form tracking and more — on a single platform. Double your sales team's output with fewer tools.
Create a sequence — it's free